PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013623622.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family EIL
Protein Properties Length: 483aa    MW: 55064.5 Da    PI: 4.6463
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013623622.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3441.57.4e-135333751354
                     XXXXXXXXXXXXXXXXXXXXXXX..XXXXX...XXXXXXX.........XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
            EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaa..tgakksn.........ksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpv 84 
                     ++lkkrmwkd++l+++lk++kk+      ++  t+    +         ++ e++rrkkm+r+QD++LkYM+k+mevc+a+GfvYgi+pekgkpv
  XP_013623622.1  33 DDLKKRMWKDRNLMCKLKQQKKDDHDLSYPSssTSPP--SsspsssaivRRAEASRRKKMARSQDSVLKYMMKIMEVCKARGFVYGIVPEKGKPV 125
                     79********************987766665333333..2458888999********************************************** PP

                     XXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S CS
            EIN3  85 egasdsLraWWkekvefdrngpaaisky...qaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtG 176
                     +g+sdsLr+WWke+v+fd+++p+a+++y   +a++li+s+es +   ++s+ h+l+elqDTtlgSLLsalmqhc ppqrrfplekg++pPWWP G
  XP_013623622.1 126 TGSSDSLRRWWKENVQFDQTAPTAVADYltlAAAQLISSSESLD---PNSYIHMLHELQDTTLGSLLSALMQHCVPPQRRFPLEKGLAPPWWPDG 217
                     ******************************9999***9977766...9*********************************************** PP

                     --HHHHHHT.--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXXXXXXX CS
            EIN3 177 kelwwgelg.lskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahssslrkq 270
                     +elwwge+g ++ ++g+ppy+kphdl+kawkvsvL+avikhmsp++e++r+l+rqsk+lqdkm+ake++++++vlnqee+++             
  XP_013623622.1 218 TELWWGEQGaTAFEHGPPPYRKPHDLRKAWKVSVLAAVIKHMSPNLERVRRLARQSKCLQDKMMAKETDTWSRVLNQEEALL------------- 299
                     *********9999******************************************************************966............. PP

                     XXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXXX CS
            EIN3 271 spkvtlsceqkedvegkkeskikhvqavkttagfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqney 354
                      +++++s+++  dv++++++  +      + +++++ +krk k++e++ ++ ++v +tcq+s++++s+++l+f dkn ++ +e+
  XP_013623622.1 300 -KRLKISDDD--DVDEEDQEP-A---RIIALDQEQMGNKRKGKFVEEEGAMLSNV-YTCQNSSCPSSDVSLGFVDKNLRTGHEM 375
                     .578888874..555444444.2...2334457899********99998888865.************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048734.3E-12433296No hitNo description
Gene3DG3DSA:1.10.3180.101.1E-67172303IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167682.35E-58174299IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MVEVQDMEPL SPIQDDDDCE DELDRVNEDI SYDDLKKRMW KDRNLMCKLK QQKKDDHDLS  60
YPSSSTSPPS SSPSSSAIVR RAEASRRKKM ARSQDSVLKY MMKIMEVCKA RGFVYGIVPE  120
KGKPVTGSSD SLRRWWKENV QFDQTAPTAV ADYLTLAAAQ LISSSESLDP NSYIHMLHEL  180
QDTTLGSLLS ALMQHCVPPQ RRFPLEKGLA PPWWPDGTEL WWGEQGATAF EHGPPPYRKP  240
HDLRKAWKVS VLAAVIKHMS PNLERVRRLA RQSKCLQDKM MAKETDTWSR VLNQEEALLK  300
RLKISDDDDV DEEDQEPARI IALDQEQMGN KRKGKFVEEE GAMLSNVYTC QNSSCPSSDV  360
SLGFVDKNLR TGHEMECLYG TQEPIYQSSV SSDGLVRSIT TSDDDYSASS KGKDTIDYLN  420
QDGNWLDYLW FERLHDFSCS DQATAVDLNQ LPDHSDSNPT VNEEDFSLWD MGCEDRDIYM  480
SRD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A2e-571723021130Protein ETHYLENE INSENSITIVE 3
4zds_B2e-571723021130Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013623622.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 5 protein
SwissprotQ9FJQ50.0EIL5_ARATH; ETHYLENE INSENSITIVE 3-like 5 protein
TrEMBLA0A0D3BEW00.0A0A0D3BEW0_BRAOL; Uncharacterized protein
STRINGfgenesh2_kg.8__2548__AT5G65100.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58792747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65100.10.0EIL family protein